General Information

  • ID:  hor002489
  • Uniprot ID:  O77060(78-87)
  • Protein name:  Hym-176
  • Gene name:  Hym-176
  • Organism:  Hydra vulgaris (Hydra) (Hydra attenuata)
  • Family:  NA
  • Source:  animal
  • Expression:  strongly in peduncle neurons;weakerly in neurons of the gastric region and around the mouth
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Hydra (genus), Hydridae (family), Aplanulata (suborder), Anthoathecata (order), Hydroidolina (subclass), Hydrozoa (class), Cnidaria (phylum), Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  GO:0016020 membrane

Sequence Information

  • Sequence:  APFIFPGPKV
  • Length:  10(78-87)
  • Propeptide:  MSKINKLTMYVFYALLVLNIYVVLSVNSLPFRDDEDTDNEIDGDISELENEYQTNQVYDYNKFKNQADLKIKARNHYAPFIFPGPKVGRDVNFHSVLSPSDESRKSFNNYHENGYRHDKPAFLFKGYKPGDQTQKNL
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O77060-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002489_AF2.pdbhor002489_ESM.pdb

    Please select some value
    Remove Label
    Add Label

    Please select some value
    Remove Label
    Add Label

Physical Information

Mass: 123302 Formula: C55H81N11O11
Absent amino acids: CDEHLMNQRSTWY Common amino acids: P
pI: 9.7 Basic residues: 1
Polar residues: 1 Hydrophobic residues: 5
Hydrophobicity: 70 Boman Index: 1212
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 78
Instability Index: 5829 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  9849871
  • Title:  The Structure and Expression of a Preprohormone of a Neuropeptide, Hym-176 in Hydra Magnipapillata